Skip to main content
Back to Blog
Trends & Insights
2 min read
December 28, 2024

The End of Third-Party Cookies: What Businesses Need to Do Now

Third-party cookies are being phased out across all major browsers. Here is how this affects your marketing, analytics, and advertising strategy.

Ryel Banfield

Founder & Lead Developer

Third-party cookies tracked users across websites for targeted advertising and analytics. Safari and Firefox blocked them years ago. Chrome's deprecation is completing the shift. Here is what it means for your business.

What You Are Losing

  1. Cross-site tracking: Cannot follow users from your site to other sites
  2. Retargeting precision: Showing your ads to people who visited your site is harder
  3. Conversion attribution: Knowing which ad led to a purchase is less reliable
  4. Audience building: Creating lookalike audiences from website visitor data
  5. Multi-touch attribution: Understanding the full customer journey across sites

What Replaces Cookies

First-Party Data (Your Data)

The most valuable replacement is data you collect directly:

  • Email addresses from signups and purchases
  • On-site behavior (pages viewed, products browsed)
  • CRM data (purchase history, support interactions)
  • Survey and feedback data

Privacy-Preserving APIs

  • Topics API: Browser-based interest categories (Google)
  • Attribution Reporting API: Conversion measurement without individual tracking
  • Protected Audiences: On-device ad auction (formerly FLEDGE)

Server-Side Tracking

Move tracking logic from client-side (JavaScript) to server-side:

  • Server-side GTM: Google Tag Manager on your server
  • Conversion APIs: Facebook CAPI, Google Enhanced Conversions
  • First-party endpoints: Track events through your own domain

Business Impact by Channel

ChannelImpactMitigation
Google AdsModerate (Enhanced Conversions helps)First-party data, server-side tracking
Facebook/Meta AdsHigh (rely heavily on pixel data)Conversions API, first-party audiences
Display advertisingVery high (retargeting gutted)Contextual targeting, first-party data
Email marketingLow (first-party channel)Invest more here
SEONone (organic traffic)Double down on content
AnalyticsModerate (cross-domain tracking affected)Server-side analytics, Plausible

What Businesses Should Do Now

  1. Invest in first-party data collection: Email lists, accounts, loyalty programs
  2. Implement server-side tracking: Move conversion tracking server-side
  3. Shift budget to owned channels: Email, SEO, content marketing
  4. Use privacy-friendly analytics: Plausible, Fathom (no cookies needed)
  5. Build direct relationships: Newsletter subscribers are more valuable than anonymous visitors
  6. Explore contextual advertising: Target by content, not by user behavior

The Opportunity

Businesses that invested in first-party data and owned channels are actually better positioned now. They have direct relationships with customers while competitors scramble to replace cookie-based strategies.

The end of third-party cookies is not a crisis. It is a correction that rewards businesses building genuine relationships with their audience.

cookiesprivacyadvertisingmarketingtrends

Ready to Start Your Project?

RCB Software builds world-class websites and applications for businesses worldwide.

Get in Touch

Related Articles